RRP1B Antibody

  • Contact Vendor

Target Rrp1b
Species Cross Reactivity Rattus norvegicus, Mus musculus, Bos taurus, Gallus gallus, Homo sapiens, Xenopus laevis
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym Nnp1, ribosomal RNA processing 1 homolog B (S. cerevisiae), RRP1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases KIAA0179, NNP1L, Nnp1, RRP1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the middle region of human RRP1B. Peptide sequence VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP