RRP1B Antibody

  • Contact Vendor

Target Rrp1b
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym Nnp1, ribosomal RNA processing 1 homolog B (S. cerevisiae), RRP1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases KIAA0179, NNP1L, Nnp1, RRP1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SISQLSFAEDISADEDDQILSQGKHKKKGNKLLEKTNLEKEKGSRVFCVEEEDSESSLQKRRRKKKKKHHLQPENPGPGGAAPSLEQNRGREPEASGLKALKARVAEPGAEATSSTG