RRP15 Antibody

  • Contact Vendor

Target RRP15
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym CGI-115, KIAA0507Ribosomal RNA-processing protein 15, MGC22291, ribosomal RNA processing 15 homolog (S. cerevisiae), RRP15-like protein
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases KIAA0507, MGC22291
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGDAEPCDKENENDGESSVGTN