RRP36 Antibody

  • Contact Vendor

Target rrp36
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym C6orf153, chromosome 6 open reading frame 153, dJ20C7.4, ribosomal RNA processing 36 homolog (S. cerevisiae), ribosomal RNA processing protein 36 homolog, RNA processing factor
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases C6orf153, dJ20C7.4
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQ