RRP7A Antibody

  • Contact Vendor

Target Rrp7a
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym BK126B4.3, CGI-96, CTA-126B4.5, Gastric cancer antigen Zg14, MGC150422, MGC150423, ribosomal RNA processing 7 homolog A (S. cerevisiae), ribosomal RNA-processing protein 7 homolog A
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases BK126B4.3, CGI-96, MGC150422, MGC150423
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYA