RRP7A Antibody

  • Contact Vendor

Target Rrp7a
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Bos taurus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym BK126B4.3, CGI-96, CTA-126B4.5, Gastric cancer antigen Zg14, MGC150422, MGC150423, ribosomal RNA processing 7 homolog A (S. cerevisiae), ribosomal RNA-processing protein 7 homolog A
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases BK126B4.3, CGI-96, MGC150422, MGC150423
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to CTA-126B4.3(CGI-96 protein) The peptide sequence was selected from the N terminal of CTA-126B4.3. Peptide sequence NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVP