HUCE1 Antibody

  • Contact Vendor

Target rrp8
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym Cerebral protein 1, KIAA0409EC 2.1.1.-, NML, Nucleomethylin, nucleomethylin, ribosomal RNA processing 8, methyltransferase, homolog (yeast), ribosomal RNA-processing protein 8, RRP8 methyltransferase homolog
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases KIAA0409
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNSVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFC