RRP9 Antibody

  • Contact Vendor

Target RRP9
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym RNA, U3 small nucleolar interacting protein 2, ribosomal RNA processing 9, small subunit (SSU) processome component, homolog(yeast), RNU3IP2, RRP9 homolog, U3 small nucleolar ribonucleoprotein-associated 55 kDa protein, U3 small nucleolar RNA-interacting protein 2, U3 snoRNP-associated 55 kDa protein, U3 snoRNP-associated 55-kDa protein, U355K, U3-55KRRP9, small subunit (SSU) processome component, homolog
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases RNU3IP2, U3-55K
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RRP9 (RRP9, small subunit (SSU) processome component, homolog (yeast)) The peptide sequence was selected from the middle region of RRP9. Peptide sequence IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSC