RRP9 Antibody

  • Contact Vendor

Target RRP9
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym RNA, U3 small nucleolar interacting protein 2, ribosomal RNA processing 9, small subunit (SSU) processome component, homolog(yeast), RNU3IP2, RRP9 homolog, U3 small nucleolar ribonucleoprotein-associated 55 kDa protein, U3 small nucleolar RNA-interacting protein 2, U3 snoRNP-associated 55 kDa protein, U3 snoRNP-associated 55-kDa protein, U355K, U3-55KRRP9, small subunit (SSU) processome component, homolog
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases RNU3IP2, U3-55K
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:THQLYSTSHDRSVKVWNVAENSYVETLFGHQDAVAALDALSRECCVTAGGRDGTVRVWKIPEESQLVFYGHQGSIDCIHLINEEHMVSGADDGSVALWGLSKKRPL