RSK3 Antibody

  • Contact Vendor

Target RPS6KA2
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym EC 2.7.11, EC 2.7.11.1, HU-2, MAP kinase-activated protein kinase 1c, MAPKAPK1C, MAPKAPK-1c, MAPK-activated protein kinase 1c, MAPKAP kinase 1c, p90-RSK 2, p90RSK2, p90-RSK3, ribosomal protein S6 kinase alpha 2, ribosomal protein S6 kinase alpha-2, Ribosomal S6 kinase 3,90 kDa ribosomal protein S6 kinase 2, ribosomal protein S6 kinase, 90kDa, polypeptide 2, ribosomal protein S6 kinase, 90kD, polypeptide 2, RSK, RSK-3, RSK3pp90RSK3, S6K-alpha, S6K-alpha2, S6K-alpha-2
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases HU-2, MAPKAPK1C, RSK, RSK3, S6K-alpha, S6K-alpha2, p90-RSK3, pp90RSK3
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPS6KA2(ribosomal protein S6 kinase, 90kDa, polypeptide 2) The peptide sequence was selected from the middle region of RPS6KA2. Peptide sequence LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR