RBFA Antibody

  • Contact Vendor

Target rbfA
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym C18orf22, chromosome 18 open reading frame 22, FLJ21172, FLJ18505, FLJ18281, FLJ97160, FLJ42604, HsT169, putative ribosome-binding factor A, mitochondrial, ribosome binding factor A (putative)
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases C18orf22, FLJ18281, FLJ18505, FLJ21172, FLJ42604, FLJ97160, HsT169
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADFGPRDERDNFVQNDFR