RPS19BP1 Antibody

  • Contact Vendor

Target Rps19bp1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym 40S ribosomal protein S19-binding protein 1, AROS, dJ1104E15.4, FLJ21770, homolog of mouse S19 binding protein, MGC52010RPS19-binding protein 1, ribosomal protein S19 binding protein 1, S19BPactive regulator of SIRT1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases AROS, FLJ21770, MGC52010, S19BP, dJ1104E15.4
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS