RRBP1 Antibody

  • Contact Vendor

Target RRBP1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym 180 kDa ribosome receptor homolog, DKFZp586A1420, ES/130, ES/130-related protein, ES130, FLJ36146, hES, KIAA1398, MGC157720, MGC157721, ribosome binding protein 1 (dog 180kD homolog), ribosome binding protein 1 homolog 180kDa (dog), Ribosome receptor protein, ribosome-binding protein 1, RRp
Unit 0.1 ml
Format Immunogen affinity purified
Concentration 0.2 mg/ml
NCBI Gene Aliases DKFZp586A1420, ES/130, ES130, FLJ36146, MGC157720, MGC157721, hES
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QLCLIEAQTMEALLALLPELSVLAQQNYTEWLQDLKEKGPTLLKHPPAPAEPSSDLASKLREAEETQSTLQAECDQYRSILAETEGMLRDLQKSVEEEEQVWRAKVGAAEEELQKSRVTVKHLE