BXDC5 Antibody

  • Contact Vendor

Target RPF1
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Bos taurus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym 2310066N05Rik, BBR140, brix domain containing 5, Brix domain-containing protein 5, BXDC5, DKFZp761G0415, DKFZp761M0215, FLJ12475, Ribosome biogenesis protein RPF1, ribosome production factor 1, ribosome production factor 1 homolog (S. cerevisiae), RNA processing factor 1 (RPF1), RP11-118B23.1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases BXDC5, DKFZp761G0415, DKFZp761M0215, FLJ12475, RP11-118B23.1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the N terminal of human BXDC5. Peptide sequence AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD