BXDC1 Antibody

  • Contact Vendor

Target RPF2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym bA397G5.4, brix domain containing 1, Brix domain-containing protein 1, BXDC1, FLJ21087, homolog of Rpf2, Ribosome biogenesis protein RPF2 homolog, ribosome production factor 2 homolog, ribosome production factor 2 homolog (S. cerevisiae), ribosomal processing factor 2 homolog
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases BXDC1, FLJ21087, bA397G5.4
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKK