RPE Antibody

  • Contact Vendor

Target RPE
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 5.1.3.1, MGC2636, Ribulose-5-phosphate-3-epimerase, ribulose-5-phosphate-3-epimerase, ribulose-phosphate 3-epimerase, RPE2-1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MGC2636, RPE2-1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKR