RPE Antibody

  • Contact Vendor

Target RPE
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym EC 5.1.3.1, MGC2636, Ribulose-5-phosphate-3-epimerase, ribulose-5-phosphate-3-epimerase, ribulose-phosphate 3-epimerase, RPE2-1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases MGC2636, RPE2-1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPE(ribulose-5-phosphate-3-epimerase) The peptide sequence was selected from the middle region of RPE. Peptide sequence MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK