RIC8 Antibody

  • Contact Vendor

Target Ric8a
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym RIC8, RIC8A resistance to inhibitors of cholinesterase 8 homolog A (C. elegans), synembryn, synembryn-A
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases MGC104517, MGC131931, MGC148073, MGC148074, RIC8
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RIC8A (resistance to inhibitors of cholinesterase 8 homolog A (C. elegans)) The peptide sequence was selected from the N terminal of RIC8A. Peptide sequence KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKG