RIC8 Antibody

  • Contact Vendor

Target Ric8b
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym Brain synembrin, hSyn, Protein Ric-8B, RIC8, RIC8B resistance to inhibitors of cholinesterase 8 homolog B (C. elegans), synembryn, synembryn-B
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FLJ10620, MGC39476, RIC8, hSyn
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RIC8B(resistance to inhibitors of cholinesterase 8 homolog B (C. elegans)) The peptide sequence was selected from the middle region of RIC8B. Peptide sequence KETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPV