Dysadherin Antibody

  • Contact Vendor

Target Fxyd5
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym DYSAD, Dysadherin, dysadherin, FXYD domain containing ion transport regulator 5, FXYD domain-containing ion transport regulator 5, IWU1, KCT1, keratinocytes associated transmembrane protein 1, OIT2, PRO6241, RIC
Unit 0.1 ml
Format Immunogen affinity purified
Concentration 0.2 mg/ml
NCBI Gene Aliases DYSAD, IWU1, KCT1, OIT2, PRO6241, RIC
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLR