RICTOR Antibody

  • Contact Vendor

Target RICTOR
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym AVO3, AVO3 homolog, hAVO3, KIAA1999DKFZp686B11164, mAVO3, MGC39830, PIA, pianissimo, rapamycin-insensitive companion of mTOR, RPTOR independent companion of MTOR, complex 2, TORC2-specific protein AVO3
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp686B11164, KIAA1999, MGC39830, PIA, mAVO3
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RCIDIQQSNEVERTQALRLVRKMITVNASLFPSSVTNSLIAVGNDGLQERDRMVRACIAIICELALQNPEVVALRGGLNTILKNVIDCQLSRINE