Rffl Antibody

  • Contact Vendor

Target Rffl
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym CARP-2, Caspases-8 and -10-associated RING finger protein 2, Caspase regulator CARP2, E3 ubiquitin-protein ligase rififylin, EC 6.3.2.-, EC 6.3.2, Fring, fring, FYVE-RING finger protein Sakura, RIFIFYLIN, rififylin, ring finger and FYVE-like domain containing 1, RING finger and FYVE-like domain-containing protein 1, RING finger protein 34-like, RING finger protein 189, RNF189CARP2, RNF34LFRING
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CARP-2, CARP2, FRING, RIFIFYLIN, RNF189, RNF34L
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MKVKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVISQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPTSPNLPSSS