RPS15 Antibody

  • Contact Vendor

Target rps15
Species Cross Reactivity Caenorhabditis elegans, Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym 40S ribosomal protein S15, homolog of rat insulinoma, MGC111130, RIG protein, RIGinsulinoma protein, ribosomal protein S15
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases MGC111130, RIG, S15
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPS15(ribosomal protein S15) The peptide sequence was selected from the middle region of RPS15. Peptide sequence GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL