Ube2L6 Antibody

  • Contact Vendor

Target UBE2L6
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym EC 6.3.2.19, RIG-B, Retinoic acid-induced gene B protein, retinoic acid induced gene B protein, ubiquitin/ISG15-conjugating enzyme E2 L6, ubiquitin-conjugating enzyme E2L 6, UbcH8, UBCH8MGC40331, Ubiquitin carrier protein L6, Ubiquitin-protein ligase L6
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases MGC40331, RIG-B, UBCH8
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to UBE2L6(ubiquitin-conjugating enzyme E2L 6) The peptide sequence was selected from the middle region of UBE2L6. Peptide sequence QVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP