DDX58 Antibody

  • Contact Vendor

Target Ddx58
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym DEAD (Asp-Glu-Ala-Asp) box polypeptide 58, DEAD box protein 58, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, DKFZp686N19181, EC 3.6.4.13, FLJ13599, probable ATP-dependent RNA helicase DDX58, RIG-1, RIG-IDKFZp434J1111, RNA helicase RIG-I, Retinoic acid-inducible gene 1 protein, Retinoic acid-inducible gene I protein, retinoic acid inducible gene I
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases DKFZp434J1111, DKFZp686N19181, FLJ13599, RIG-I
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to DDX58(DEAD (Asp-Glu-Ala-Asp) box polypeptide 58) The peptide sequence was selected from the middle region of DDX58. Peptide sequence EECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIH