Robo3 Antibody

  • Contact Vendor

Target Robo3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym FLJ21044, HGPPS, HGPS, RBIG1horizontal gaze palsy with progressive scoliosis, retinoblastoma inhibiting gene 1, RIG1, roundabout, axon guidance receptor, homolog 3 (Drosophila), Roundabout-like protein 3, roundabout (axon guidance receptor, Drosophila) homolog 3, roundabout homolog 3
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ21044, HGPPS, HGPS, RBIG1, RIG1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EGPVYSTIDPAGEELQTFHGGFPQHPSGDLGPWSQYAPPEWSQGDSGAKGGKVKLLGKPVQMPSLNWPEALPPPPPSCELSCLEGPEEELEGSSEPEEWCPPMPERSHLTE