RARRES3 Antibody

  • Contact Vendor

Target RARRES3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym HRASLS4, PLA1/2-3, RAR-responsive protein TIG3, Retinoid-inducible gene 1 protein, RIG1, retinoic acid-inducible gene 1, retinoic acid receptor responder (tazarotene induced) 3, retinoic acid receptor responder protein 3, Tazarotene-induced gene 3 protein, TIG3MGC8906
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases HRASLS4, MGC8906, PLA1/2-3, RIG1, TIG3
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RARRES3(retinoic acid receptor responder (tazarotene induced) 3) The peptide sequence was selected from the middle region of RARRES3. Peptide sequence FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV