RARRES3 Antibody

  • Contact Vendor

Target RARRES3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym HRASLS4, PLA1/2-3, RAR-responsive protein TIG3, Retinoid-inducible gene 1 protein, RIG1, retinoic acid-inducible gene 1, retinoic acid receptor responder (tazarotene induced) 3, retinoic acid receptor responder protein 3, Tazarotene-induced gene 3 protein, TIG3MGC8906
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases HRASLS4, MGC8906, PLA1/2-3, RIG1, TIG3
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEK