RIIAD1 Antibody

  • Contact Vendor

Target RIIAD1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym NCRNA00166, regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1, RIIa domain-containing protein 1, RIIa domain-containing protein ENSP00000357824
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases C1orf230, FLJ36032, NCRNA00166
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIH