PRICKLE1 Antibody

  • Contact Vendor

Target prickle1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym EPM1BMGC138902, FLJ31627, FLJ31937, prickle homolog 1 (Drosophila), prickle-like 1, prickle-like 1 (Drosophila), prickle-like protein 1, REST (RE-1 silencing transcription factor)/NRSF (neuron-restrictive silencerfactor)-interacting LIM domain protein, REST/NRSF-interacting LIM domain protein 1, RILPMGC138903
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases EPM1B, FLJ31627, FLJ31937, MGC138902, MGC138903, RILP
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSLALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNMGTLNSSMLHRSAESLKSLSSELCPEKILPEEKPVHLPVLRRSKSQSRPQQVKFSDDVIDNGNYDIEI