RILPL1 Antibody

  • Contact Vendor

Target rilpl1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym FLJ39378, MGC105128, MGC99793, Rab interacting lysosomal protein-like 1, Rab-interacting lysosomal-like protein 1, RILP-like protein 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ39378, MGC105128, MGC99793
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKDVNFSEEEFQKHEGMSERERQVMKKLKEV