RILPL2 Antibody

  • Contact Vendor

Target Rilpl2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym FLJ30380, FLJ32372, MGC7036, p40phox-binding protein, Rab interacting lysosomal protein-like 2, Rab-interacting lysosomal protein-like 2, RILP-like protein 2, RLP2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ30380, FLJ32372, MGC7036
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVRVLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRDVLQERNKLK