RIMBP3 Antibody

  • Contact Vendor

Target RIMBP3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym KIAA1666DKFZp434H0735, RIM-BP3, RIM-BP3.1, RIM-BP3.A, RIMBP3ARIMBP3.1, RIMS binding protein 3, RIMS binding protein 3.1, RIMS-binding protein 3.1, RIMS-binding protein 3A
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp434H0735, KIAA1666, RIM-BP3.1, RIM-BP3.A, RIMBP3.1, RIMBP3A
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RDTASEVDDLEPDSVSLALEMGGSAAPAAPKLKIFMAQYNYNPFEGPNDHPEGELPLTAGDYIYIFGDMDEDGFYEGELEDGRRGLVPSNFVEQIPDSYIPGCLPAKSPDLGPSQLPAGQDEALEE