FAM80A Antibody

  • Contact Vendor

Target RIMKLA
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 6.3.2.n6, FAM80A, family with sequence similarity 80, member A, MGC47816, NAAG synthetase A, NAAGS, ribosomal modification protein rimK-like family member A, Ribosomal protein S6 modification-like protein A, RP11-157D18.1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FAM80A, MGC47816, NAAGS
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DYTMSLLPNRQTGKMAVLPGLSSPREKNEPDGCASAQGVAESVYTINSGSTSSESEPELGEIRDSSASTMGAPPSMLPEPGYNINNRIASELK