FAM80A Antibody

  • Contact Vendor

Target RIMKLA
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym EC 6.3.2.n6, FAM80A, family with sequence similarity 80, member A, MGC47816, NAAG synthetase A, NAAGS, ribosomal modification protein rimK-like family member A, Ribosomal protein S6 modification-like protein A, RP11-157D18.1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FAM80A, MGC47816, NAAGS
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to FAM80A(family with sequence similarity 80, member A) The peptide sequence was selected from the middle region of FAM80A. Peptide sequence EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV