RIMS1 Antibody

  • Contact Vendor

Target RIMS1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym regulating synaptic membrane exocytosis 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CORD7, KIAA0340, MGC167823, MGC176677, RAB3IP2, RIM, RIM1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YSSILPAHTKTKSVTRQDISLHHECFNSTVLRFTDEILVSELQPFLDRARSASTNCLRPDTSLHSPERERGRWSPSLDRRRPPSP