RIMS3 Antibody

  • Contact Vendor

Target Rims3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym KIAA0237, KIAA0137, Nim3, NIM3Rab-3 interacting molecule 3, Rab-3-interacting molecule 3, regulating synaptic membrane exocytosis 3, regulating synaptic membrane exocytosis protein 3, RIM 3, RIM3, RIM3 gamma
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases KIAA0237, NIM3, RIM3
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FNGEPGPASSGASRNVVRSSSISGEICGSQQAGGGAGTTTAKKRRSSLGAKMV