RIN2 Antibody

  • Contact Vendor

Target RIN2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym RAB5 interacting protein 2, Ras inhibitor JC265, Ras interaction/interference protein 2, RASSF4MACS, Ras and Rab interactor 2, RAS association (RalGDS/AF-6) domain containing protein JC265, Ras association domain family 4
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MACS, RASSF4
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GEMTAWTMGARGLDKRGSFFKLIDTIASEIGELKQEMVRTDVNLENGLEPAETHSMVRHKDGGYSEEEDVKTCAR