Roquin Antibody

  • Contact Vendor

Target RC3H1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym KIAA2025RP5-1198E17.5, RING finger and C3H zinc finger protein 1, ring finger and CCCH-type domains 1, RING finger protein 198, RNF198ring finger and CCCH-type zinc finger domains 1, ROQUIN, roquin
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases KIAA2025, RNF198, ROQUIN
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AHSQEELEKFRKMNKRLVPRRPLSASLGQLNEVGLPSAAILPDEGAVDLPSRKPPALPNGIVSTGNTVTQLIPRGTDPSYDSSLKPG