MNAB Antibody

  • Contact Vendor

Target RC3H2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym FLJ20713, FLJ20301, membrane associated DNA binding protein, membrane-associated nucleic acid binding protein, Membrane-associated nucleic acid-binding protein, MGC52176, MNAB, ring finger and CCCH-type domains 2, RING finger and CCCH-type zinc finger domain-containing protein 2, ring finger and CCCH-type zinc finger domains 2, RNF164RING finger protein 164
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FLJ20301, FLJ20713, MGC52176, MNAB, RNF164
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RC3H2(ring finger and CCCH-type zinc finger domains 2) The peptide sequence was selected from the middle region of RC3H2. Peptide sequence YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR