RSPRY1 Antibody

  • Contact Vendor

Target Rspry1
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym KIAA1972RING finger and SPRY domain-containing protein 1, ring finger and SPRY domain containing 1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases KIAA1972
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RSPRY1(ring finger and SPRY domain containing 1) The peptide sequence was selected from the N terminal of RSPRY1. Peptide sequence RSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPY