RNF6 Antibody

  • Contact Vendor

Target Rnf6
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym DKFZp686P0776, E3 ubiquitin-protein ligase RNF6, EC 6.3.2.-, ring finger protein (C3H2C3 type) 6, RING-H2 protein RNF-6, SPG2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp686P0776
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TLGRLRNGIGGAAGIPRANASRTNFSSHTNQSGGSELRQREGQRFGAAHVWENGARSNVTVRNTNQRLEPIRLRST