MKRN1 Antibody

  • Contact Vendor

Target MKRN1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym E3 ubiquitin-protein ligase makorin-1, EC 6.3.2.-, FLJ21334, makorin ring finger protein 1, RNF61RING finger protein 61
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ21334, RNF61
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NEHRFGILSNCNHTFCLKCIRKWRSAKEFESRIVKSCPQCRITSNFVIPSEYWVEEKEEKQKLIQKYKEAMSNKACKYFDEGRGSCPFGENCFYKHMYPDGRREEPQRQQVGTSSRNPGQQRNHFWEFFEEGANSNPFDDEEEAV