MKRN1 Antibody

  • Contact Vendor

Target MKRN1
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym E3 ubiquitin-protein ligase makorin-1, EC 6.3.2.-, FLJ21334, makorin ring finger protein 1, RNF61RING finger protein 61
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases FLJ21334, RNF61
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to MKRN1(makorin, ring finger protein, 1) The peptide sequence was selected from the N terminal of MKRN1. Peptide sequence GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE