RNF10 Antibody

  • Contact Vendor

Target Rnf10
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym KIAA0262RIE2MGC126758, MGC126764, ring finger protein 10
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases KIAA0262, MGC126758, MGC126764, RIE2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:REKGVLVALPKSKWMNVDHPIHLGDEQHSQYSKLLLASKEQVLHRVVLEEKVALEQQLAEEKHTPESCFIEAAIQELKTREEALSGLAGSRREVTGVVAALEQLVLM