RNF111 Antibody

  • Contact Vendor

Target RNF111
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym Arkadia, ARK, DKFZp313E0731, DKFZP761D081, DKFZp761D081, E3 ubiquitin-protein ligase Arkadia, EC 6.3.2.-, EC 6.3.2, FLJ38008, ring finger protein 111DKFZp686H1966
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases ARK, DKFZp313E0731, DKFZp686H1966, DKFZp761D081, FLJ38008
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYVQNCVKENQGI